PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00047957-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 108aa    MW: 12409 Da    PI: 4.3633
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00047957-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49.2e-102866444
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                      +++eE++l+++  k+ G++ W++Ia +++ gR ++++  +w
  PSME_00047957-RA 28 MSEEEEDLILRMYKLIGNK-WSLIAGRIP-GRKAEEIERYW 66
                      69*****************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.3E-42472IPR001005SANT/Myb domain
PfamPF002497.4E-92867IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-72867IPR009057Homeodomain-like
CDDcd001673.51E-72866No hitNo description
Gene3DG3DSA:1.10.10.603.7E-122967IPR009057Homeodomain-like
PROSITE profilePS500906.6442966IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MEKNVYCSTS ILEYDTEEGS SLDWECDMSE EEEDLILRMY KLIGNKWSLI AGRIPGRKAE  60
EIERYWAMRT QQFCGSHGAT IFASNKQMGN MISIPYHING CNDVEVNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261513.12e-24PREDICTED: transcription factor TRY-like
SwissprotQ8GV051e-23TRY_ARATH; Transcription factor TRY
TrEMBLD5ACZ16e-23D5ACZ1_PICSI; Putative uncharacterized protein
STRINGVIT_16s0050g02530.t013e-21(Vitis vinifera)
STRINGAT5G53200.13e-21(Arabidopsis thaliana)
STRINGBra037388.1-P2e-21(Brassica rapa)
STRINGfgenesh1_pg.C_scaffold_80013503e-21(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.18e-25MYB_related family protein